Rabbit Polyclonal Anti-GABRG2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-GABRG2 antibody is: synthetic peptide directed towards the N-terminal region of Human GABRG2. Synthetic peptide located within the following region: VPEGDVTVILNNLLEGYDNKLRPDIGVKPTLIHTDMYVNSIGPVNAINME |
Rabbit Polyclonal Anti-GABA (A) gamma2 Receptor (extracellular)
| Applications | IF, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Peptide QKSDDDYEDYASNKT(C), corresponding to amino acid residues 39-53 of rat GABA(A) ?2 Receptor. Extracellular, N-terminus. |
GABA A Receptor gamma 2 (GABRG2) (400-410) goat polyclonal antibody, Aff - Purified
| Applications | ELISA, WB |
| Reactivities | Bovine, Human, Mouse, Rat |
| Immunogen | Peptide with sequence from the internal region of the protein sequence according to NP_944494.1; NP_000807.2; NP_944493.2. |
Rabbit Anti-GABAA Receptor g2 Antibody
| Applications | WB |
| Reactivities | Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to amino acid residues specific to the gamma 2 subunit conjugated to KLH |
Rabbit Anti-GABAA Receptor, g 2 (Ser327) Antibody (Phospho-Specific)
| Applications | WB |
| Reactivities | Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic phospho-peptide corresponding to amino acid residues surrounding Ser327 conjugated to KLH |
| Modifications | Phospho-specific |
Rabbit Polyclonal Anti-GABRG2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-GABRG2 antibody: synthetic peptide directed towards the N terminal of human GABRG2. Synthetic peptide located within the following region: GFTSQKSDDDYEDYASNKTWVLTPKVPEGDVTVILNNLLEGYDNKLRPDI |
Rabbit Polyclonal Anti-GABRG2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-GABRG2 antibody: synthetic peptide directed towards the C terminal of human GABRG2. Synthetic peptide located within the following region: AMDLFVSVCFIFVFSALVEYGTLHYFVSNRKPSKDKDKKKKNPAPTIDIR |
GABRG2 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide corresponding to a sequence within amino acids 170-270 of human GABRG2 (NP_000807.2). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China
