Antibodies

Jump to Filters
View as table Download
GATD3A Rabbit Polyclonal Antibody
TA338921

USD 310.00

5 Days

Rabbit Polyclonal Anti-C21orf33 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-C21orf33 antibody: synthetic peptide directed towards the N terminal of human C21orf33. Synthetic peptide located within the following region: SRGGAEVQIFAPDVPQMHVIDHTKGQPSEGESRNVLTESARIARGKITDL