Rabbit Polyclonal Anti-GCNT3 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-GCNT3 Antibody: synthetic peptide directed towards the C terminal of human GCNT3. Synthetic peptide located within the following region: AICVYGAGDLNWMLQNHHLLANKFDPKVDDNALQCLEEYLRYKAIYGTEL |
Goat Polyclonal Antibody against GCNT3 (aa 410 to 422)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-NKFDPKVDDNALQ, from the internal region (near C terminus) of the protein sequence according to NP_004742.1. |
GCNT3 (N-term) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human |
| Immunogen | KLH conjugated synthetic peptide between 72-102 amino acids from the N-terminal region of human GCNT3 |
Goat Polyclonal Antibody against GCNT3 (aa 273 to 284)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-RDTLHLTNKKKD, from the internal region of the protein sequence according to NP_004742.1. |
Rabbit Polyclonal Anti-GCNT3 Antibody (N-Terminus)
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | GCNT3 antibody was raised against synthetic 15 amino acid peptide from N-terminus of human GCNT3. Percent identity with other species by BLAST analysis: Human (100%); Gorilla, Gibbon, Monkey (93%); Marmoset (80%). |
Rabbit Polyclonal Anti-GCNT3 Antibody (Internal)
| Applications | IHC |
| Reactivities | Human |
| Immunogen | GCNT3 antibody was raised against synthetic 16 amino acid peptide from internal region of human GCNT3. Percent identity with other species by BLAST analysis: Human, Gorilla (100%); Chimpanzee, Orangutan, Gibbon (94%); Marmoset (88%); Monkey (81%). |
Rabbit Polyclonal Anti-GCNT3 Antibody (Internal)
| Applications | IHC |
| Reactivities | Human |
| Immunogen | GCNT3 antibody was raised against synthetic 15 amino acid peptide from internal region of human GCNT3. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Dog, Panda, Horse (100%); Marmoset, Sheep, Bovine, Pig (93%); Hamster, Rabbit, Platypus, Xenopus (80%). |
Rabbit Polyclonal Anti-GCNT3 Antibody (Internal)
| Applications | IHC |
| Reactivities | Human |
| Immunogen | GCNT3 antibody was raised against synthetic 16 amino acid peptide from internal region of human GCNT3. Percent identity with other species by BLAST analysis: Human, Gorilla (100%); Orangutan (94%); Chimpanzee, Gibbon, Monkey, Galago (88%); Marmoset, Pig (81%). |
GCNT3 rabbit polyclonal antibody
| Applications | IHC |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human GCNT3 |
GCNT3 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 27-180 of human GCNT3 (NP_004742.1). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China
