Antibodies

Jump to Filters
View as table Download
GCOM1 Rabbit Polyclonal Antibody
TA320110

USD 430.00

5 Days

Rabbit Polyclonal MYOZAP Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Immunogen MYOZAP antibody was raised against a 18 amino acid synthetic peptide near the carboxy terminus of human MYOZAP.
GCOM1 Rabbit Polyclonal Antibody
TA339965

USD 375.00

5 Days

Rabbit Polyclonal Anti-Gcom1 Antibody

Applications WB
Reactivities Human
Immunogen The immunogen for anti-Gcom1 antibody: synthetic peptide directed towards the middle region of human Gcom1. Synthetic peptide located within the following region: VAQVENQLLKMKVESSQEANAEVMREMTKKLYSQYEEKLQEEQRKHSAEK
GCOM1 Rabbit Polyclonal Antibody
TA339966

USD 375.00

5 Days

Rabbit Polyclonal Anti-Gcom1 Antibody

Applications WB
Reactivities Human
Immunogen The immunogen for anti-Gcom1 antibody: synthetic peptide directed towards the C terminal of human Gcom1. Synthetic peptide located within the following region: ERMEKERHQLQLQLLEHETEMSGELTDSDKERYQQLEEASASLRERIRHL