Rabbit Polyclonal GFR alpha 2 Antibody
| Applications | IF, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | GFR alpha 2 antibody was raised against a peptide corresponding to amino acids 377 to 391 of human GFR alpha 2. The amino acid sequences of immunogenic peptide are identical to those of mouse and rat. |
Rabbit Polyclonal Anti-GFRA2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-GFRA2 antibody: synthetic peptide directed towards the C terminal of human GFRA2. Synthetic peptide located within the following region: NVSPKGPSFQATQAPRVEKTPSLPDDLSDSTSLGTSVITTCTSVQEQGLK |
GFRA2 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 360-464 of human GFRA2 (NP_001486.4). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China
