Antibodies

Jump to Filters
View as table Download
GFRAL (C-term) Rabbit Polyclonal Antibody
AP51826PU-N

USD 450.00

2 Weeks

GFRAL (C-term) rabbit polyclonal antibody, Aff - Purified

Applications FC, IHC, WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 366-394 amino acids from the C-terminal region of human GFRAL
GFRAL Rabbit Polyclonal Antibody
TA331490

USD 375.00

5 Days

Rabbit Polyclonal Anti-GFRAL Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-GFRAL Antibody is: synthetic peptide directed towards the N-terminal region of Human GFRAL. Synthetic peptide located within the following region: TDDFYCTVNKLLGKKCINKSDNVKEDKFKWNLTTRSHHGFKGMWSCLEVA