Germany
Japan
United Kingdom
China
Rabbit Polyclonal GINS4 Antibody
| Applications | ELISA |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | DNA immunization. This antibody is specific for the C Terminus Region of the target protein. |
Antibodies
View as table Download
Rabbit Polyclonal Anti-GINS4 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-GINS4 antibody is: synthetic peptide directed towards the N-terminal region of Human GINS4. Synthetic peptide located within the following region: TEEVDFLGQDSDGGSEEVVLTPAELIERLEQAWMNEKFAPELLESKPEIV |
GINS4 Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human GINS4 |
GINS4 rabbit polyclonal antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Full length fusion protein |
GINS4 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 108-207 of human GINS4 (NP_115712.1). |
| Modifications | Unmodified |
Active filters
Target Symbol
- GINS4