Rabbit Polyclonal Anti-GJA5 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-GJA5 antibody: synthetic peptide directed towards the N terminal of human GJA5. Synthetic peptide located within the following region: STPSLVYMGHAMHTVRMQEKRKLREAERAKEVRGSGSYEYPVAEKAELSC |
Rabbit Polyclonal Anti-Connexin-40
| Applications | WB |
| Reactivities | Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Peptide (C)GHRFPQGYHSDKR, corresponding to amino acid residues 328-340 of rat Connexin-40. Intracellular, C-terminus. |
GJA5 rabbit polyclonal antibody
| Applications | ELISA, IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human GJA5 |
GJA5 rabbit polyclonal antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human GJA5 |
GJA5 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 229-358 of human GJA5 (NP_859054.1). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China