GJC2 rabbit polyclonal antibody
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human GJC2 |
GJC2 rabbit polyclonal antibody
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human GJC2 |
Rabbit Polyclonal Anti-GJC2 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-GJC2 antibody: synthetic peptide directed towards the middle region of human GJC2. Synthetic peptide located within the following region: APASRTGSATSAGTVGEQGRPGTHERPGAKPRAGSEKGSASSRDGKTTVW |
Anti-GJC2 Rabbit Polyclonal Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 420-434 amino acids of Human gap junction protein, gamma 2, 47kDa |
Anti-GJC2 Rabbit Polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 420-434 amino acids of Human gap junction protein, gamma 2, 47kDa |
GJC2 rabbit polyclonal antibody
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human GJC2 |