Antibodies

View as table Download

GJC2 rabbit polyclonal antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide of human GJC2

Rabbit Polyclonal Anti-GJC2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-GJC2 antibody: synthetic peptide directed towards the middle region of human GJC2. Synthetic peptide located within the following region: APASRTGSATSAGTVGEQGRPGTHERPGAKPRAGSEKGSASSRDGKTTVW

Anti-GJC2 Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 420-434 amino acids of Human gap junction protein, gamma 2, 47kDa

Anti-GJC2 Rabbit Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 420-434 amino acids of Human gap junction protein, gamma 2, 47kDa

GJC2 rabbit polyclonal antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide of human GJC2