Germany
Japan
United Kingdom
China
Goat Anti-GLP-1-R (mouse) Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-SKRGERNFPEEQ, from the internal region of the protein sequence according to NP_067307.2. |
Antibodies
View as table Download
Rabbit Polyclonal Anti-Glp1r Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Glp1r antibody is: synthetic peptide directed towards the middle region of Mouse Glp1r. Synthetic peptide located within the following region: YRFCTAEGLWLHKDNSSLPWRDLSECEESKRGERNFPEEQLLSLYIIYTV |
Goat Anti-GLP1R Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-QHQWDGLLSYQD, from the internal region of the protein sequence according to NP_002053.3. |
Rabbit polyclonal anti-GLP1R antibody
| Applications | IF |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human GLP1R. |
Rabbit Polyclonal Anti-GLP1R Antibody (N-Terminus)
| Applications | IHC |
| Reactivities | Human |
| Immunogen | GLP1R/GLP-1R/GLP-1 Receptor antibody was raised against synthetic 16 amino acid peptide from N-terminal extracellular domain of human GLP1R. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey (100%); Marmoset, Mouse, Rat, Sheep, Bovine, Hamster, Elephant, Rabbit, Pig (94%). |
GLP1R Rabbit polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 22-116 of human GLP1R (NP_002053.3). |
| Modifications | Unmodified |
GLP1R Rabbit polyclonal Antibody
| Applications | IF, WB |
| Reactivities | Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 22-116 of human GLP1R (NP_002053.3). |
| Modifications | Unmodified |
Active filters
Target Symbol
- GLP1R