Rabbit Polyclonal Anti-GLRX2 Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-GLRX2 antibody: synthetic peptide directed towards the middle region of human GLRX2. Synthetic peptide located within the following region: NVNYKVVELDLLEYGNQFQDALYKMTGERTVPRIFVNGTFIGGATDTHRLH |
Glutaredoxin 2 (GLRX2) (C-term) rabbit polyclonal antibody, Purified
| Applications | FC, IHC, WB |
| Reactivities | Human, Mouse |
| Immunogen | GLRX2 antibody is generated from Rabbits immunized with a KLH conjugated synthetic peptide between 126~155 amino acids from the C-terminal region of Human GLRX2. |
GLRX2 rabbit polyclonal antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human GLRX2 |
Germany
Japan
United Kingdom
China
