Rabbit Polyclonal Anti-GM2A Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-GM2A antibody: synthetic peptide directed towards the N terminal of human GM2A. Synthetic peptide located within the following region: MQSLMQAPLLIALGLLLAAPAQAHLKKPSQLSSFSWDNCDEGKDPAVIRS |
Goat Anti-GM2A (aa 164-175) Antibody
| Applications | WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-TTGNYRIESVLS, from the internal region of the protein sequence according to NP_000396.2. |
Rabbit Polyclonal Anti-GM2A Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-GM2A antibody: synthetic peptide directed towards the N terminal of human GM2A. Synthetic peptide located within the following region: SWDNCDEGKDPAVIRSLTLEPDPIIVPGNVTLSVMGSTSVPLSSPLKVDL |
Rabbit Polyclonal Anti-GM2A Antibody (Internal)
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | GM2A antibody was raised against synthetic 15 amino acid peptide from internal region of human GM2A. Percent identity with other species by BLAST analysis: Human, Chimpanzee, Gorilla, Orangutan, Gibbon (100%); Monkey, Marmoset (93%). |
Rabbit Polyclonal Anti-GM2A Antibody (N-Terminus)
| Applications | IHC |
| Reactivities | Human |
| Immunogen | GM2A antibody was raised against synthetic 17 amino acid peptide from N-terminus of human GM2A. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey (100%); Marmoset, Rat, Bovine, Cat, Elephant, Pig (88%); Mouse, Hamster, Panda, Horse, Platypus (82%). |
Rabbit Polyclonal Anti-GM2A Antibody (N-Terminus)
| Applications | IHC |
| Reactivities | Human |
| Immunogen | GM2A antibody was raised against synthetic 14 amino acid peptide from N-terminus of human GM2A. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon (100%); Monkey (86%). |
Rabbit Polyclonal Anti-GM2A Antibody (C-Terminus)
| Applications | IHC |
| Reactivities | Human |
| Immunogen | GM2A antibody was raised against synthetic 16 amino acid peptide from C-terminus of human GM2A. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon (100%); Monkey (94%); Marmoset, Mouse, Rat, Bovine, Hamster, Elephant, Horse (81%). |
GM2A rabbit polyclonal antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human GM2A |
GM2A Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 24-193 of human GM2A (NP_000396.2). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China
