Rabbit Polyclonal Anti-GMFG Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-GMFG antibody: synthetic peptide directed towards the middle region of human GMFG. Synthetic peptide located within the following region: KVDKDRQMVVLEEEFQNISPEELKMELPERQPRFVVYSYKYVHDDGRVSY |
Rabbit Polyclonal Anti-GMFG Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human GMFG |
GMFG Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-70 of human GMFG (NP_004868.1). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China