Antibodies

Jump to Filters
View as table Download
GPBP1 Rabbit Polyclonal Antibody
TA331765

USD 375.00

5 Days

Rabbit Polyclonal Anti-DKFZP761C169 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-DKFZP761C169 Antibody: synthetic peptide directed towards the N terminal of human DKFZP761C169. Synthetic peptide located within the following region: RKEKNGWRTHGRNGTENINHRGGYHGGSSRSRSSIFHAGKSQGLHENNIP
GPBP1 Rabbit Polyclonal Antibody
TA366139

USD 380.00

4 Weeks

GPBP1 rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein of human GPBP1