Antibodies

Jump to Filters
View as table Download
Glypican 2 (GPC2) Rabbit Polyclonal Antibody
TA371806

USD 380.00

4 Weeks

GPC2 rabbit polyclonal antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide of human GPC2
Glypican 2 (GPC2) Rabbit Polyclonal Antibody
TA337870

USD 375.00

5 Days

Rabbit Polyclonal Anti-GPC2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-GPC2 antibody is: synthetic peptide directed towards the C-terminal region of Human GPC2. Synthetic peptide located within the following region: GRLWSMVTEEERPTTAAGTNLHRLVWELRERLARMRGFWARLSLTVCGDS
Glypican 2 (GPC2) (N-term) Rabbit Polyclonal Antibody
AP51901PU-N

USD 450.00

2 Weeks

Glypican 2 (GPC2) (N-term) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human, Mouse
Immunogen KLH conjugated synthetic peptide between 136-165 amino acids from the N-terminal region of Human GPC2 (NP_689955.1)
GPC2 Rabbit Polyclonal Antibody
TA367579

USD 380.00

4 Weeks

GPC2 rabbit polyclonal antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide of human GPC2