Antibodies

View as table Download

GPD2 rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human GPD2

GPD2 (C-term) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen KLH conjugated synthetic peptide between 605-634 amino acids from the C-terminal region of human GPD2

Rabbit Polyclonal Anti-GPD2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-GPD2 antibody: synthetic peptide directed towards the N terminal of human GPD2. Synthetic peptide located within the following region: DILVIGGGATGSGCALDAVTRGLKTALVERDDFSSGTSSRSTKLIHGGVR

Rabbit Polyclonal Anti-GPD2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-GPD2 antibody is: synthetic peptide directed towards the N-terminal region of Human GPD2. Synthetic peptide located within the following region: LSCDVEVRRGDVLAAWSGIRPLVTDPKSADTQSISRNHVVDISESGLITI

Rabbit Polyclonal Anti-GPD2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-GPD2 antibody: synthetic peptide directed towards the middle region of human GPD2. Synthetic peptide located within the following region: GQVELNEFLQLMSAIQKGRVSGSRLAILMKTAEENLDRRVPIPVDRSCGG

Rabbit Polyclonal Anti-GPD2 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human GPD2

GPD2 rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human GPD2

GPD2 rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human GPD2

GPD2 rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human GPD2

GPD2 rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human GPD2

GPD2 Rabbit polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 25-325 of human GPD2 (NP_000399.3).
Modifications Unmodified

GPD2 Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 25-325 of human GPD2 (NP_000399.3).
Modifications Unmodified

GPD2 Rabbit monoclonal Antibody

Applications IP, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated