Germany
Japan
United Kingdom
China
Rabbit polyclonal anti-GPR135 antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human GPR135. |
Antibodies
View as table Download
Rabbit Polyclonal Anti-GPR135 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-GPR135 antibody is: synthetic peptide directed towards the C-terminal region of Human GPR135. Synthetic peptide located within the following region: SSSNPASGVAGDVAMWARKNPVVLFCREGPPEPVTAVTKQPKSEAGDTSL |
GPR135 Antibody - C-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-GPR135 antibody is: synthetic peptide directed towards the C-terminal region of Human GP135 |
GPR135 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human GPR135. |
Active filters
Target Symbol
- GPR135