Antibodies

Jump to Filters
View as table Download
Gprc5d Rabbit Polyclonal Antibody
TA334306

USD 375.00

2 Weeks

Rabbit Polyclonal Anti-Gprc5d Antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-Gprc5d antibody is: synthetic peptide directed towards the C-terminal region of Mouse Gprc5d. Synthetic peptide located within the following region: MDTQEPTRARDSDGAQEDVALTAYGTPIQLQSADPSREYLIPSATLSPQQ
GPRC5D Rabbit Polyclonal Antibody
TA376751

USD 220.00

3 Weeks

GPRC5D Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 264-345 of human GPRC5D (NP_061124.1).
Modifications Unmodified