USD 345.00
In Stock
Rabbit polyclonal GPRIN2 antibody
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from N-terminal of human GPRIN2. |
USD 345.00
In Stock
Rabbit polyclonal GPRIN2 antibody
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from N-terminal of human GPRIN2. |
USD 375.00
5 Days
Rabbit Polyclonal Anti-GPRIN2 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-GPRIN2 antibody is: synthetic peptide directed towards the N-terminal region of Human GPRIN2. Synthetic peptide located within the following region: LSQSSSSLLGEGREQRPELRKTASSTVWQAQLGEASTRPQAPEEEGNPPE |
USD 360.00
5 Days
GPRIN2 Antibody - middle region
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human GPRIN2 |