Antibodies

Jump to Filters
View as table Download
Glutathione Peroxidase 3 (GPX3) Rabbit Polyclonal Antibody
TA346086

USD 475.00

5 Days

Rabbit Polyclonal Anti-GPX3 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-GPX3 antibody: synthetic peptide directed towards the N terminal of human GPX3. Synthetic peptide located within the following region: DCHGGISGTIYEYGALTIDGEEYIPFKQYAGKYVLFVNVASYUGLTGQYI
Glutathione Peroxidase 3 (GPX3) (102-114) Goat Polyclonal Antibody
AP22523PU-N

USD 440.00

2 Weeks

Glutathione Peroxidase 3 (GPX3) (102-114) goat polyclonal antibody

Applications ELISA, IHC, WB
Reactivities Bat, Bovine, Canine, Equine, Human, Monkey, Mouse, Porcine, Rat
Immunogen Synthetic peptide from internal region of human GPX3
Gpx3 Goat Polyclonal Antibody
TA303205

USD 375.00

5 Days

Goat Polyclonal Antibody against GPX3

Applications IHC, WB
Reactivities Mouse, Pig
Conjugation Unconjugated
Immunogen Peptide with sequence C-NQFGKQEPGENSE, from the internal region of the protein sequence according to NP_002075.2.
Glutathione Peroxidase 3 (GPX3) Rabbit Polyclonal Antibody
TA309678

USD 424.00

5 Days

Rabbit Polyclonal Glutathione Peroxidase 3 Antibody

Applications WB
Reactivities Human, Primate, Rat
Conjugation Unconjugated
Immunogen Full length human GPX3 protein [Swiss-Prot# P22352] expressed in E. coli.
Glutathione Peroxidase 3 (GPX3) Rabbit Polyclonal Antibody
TA376760

USD 220.00

3 Weeks

GPX3 Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human GPX3.
Modifications Unmodified