Rabbit polyclonal Anti-GSTZ1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-GSTZ1 antibody: synthetic peptide directed towards the N terminal of human GSTZ1. Synthetic peptide located within the following region: MQAGKPILYSYFRSSCSWRVRIALALKGIDYETVPINLIKDGGQQFSKDF |
USD 465.00
In Stock
Carrier-free (BSA/glycerol-free) GSTZ1 mouse monoclonal antibody,clone OTI1A7
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
USD 465.00
In Stock
GSTZ1 Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human GSTZ1 |
GSTZ1 rabbit polyclonal antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human GSTZ1 |
GSTZ1 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-216 of human GSTZ1 (NP_665877.1). |
| Modifications | Unmodified |
USD 379.00
In Stock
GSTZ1 mouse monoclonal antibody,clone OTI1A7
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
GSTZ1 mouse monoclonal antibody,clone OTI1A7, Biotinylated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Biotin |
USD 420.00
4 Weeks
GSTZ1 mouse monoclonal antibody,clone OTI1A7, HRP conjugated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | HRP |
USD 159.00
2 Days
GSTZ1 mouse monoclonal antibody,clone OTI1A7
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
USD 379.00
In Stock
USD 420.00
4 Weeks
USD 420.00
4 Weeks
USD 159.00
2 Days
Germany
Japan
United Kingdom
China
