Rabbit Polyclonal Anti-GTDC1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-GTDC1 antibody is: synthetic peptide directed towards the N-terminal region of Human GTDC1. Synthetic peptide located within the following region: LIIEAFYGGSHKQLVDLLQEELGDCVVYTLPAKKWHWRARTSALYFSQTI |
Rabbit Polyclonal Anti-GTDC1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-GTDC1 antibody: synthetic peptide directed towards the N terminal of human GTDC1. Synthetic peptide located within the following region: CQERDFQYGYNQILSCLVADVVVFNSVFNMESFLTSMGKFMKLIPDHRPK |
Germany
Japan
United Kingdom
China