Rabbit polyclonal HAPLN1 Antibody (N-term)
| Applications | FC, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This HAPLN1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 10-38 amino acids from the N-terminal region of human HAPLN1. |
Rabbit Polyclonal Anti-HAPLN1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-HAPLN1 antibody: synthetic peptide directed towards the N terminal of human HAPLN1. Synthetic peptide located within the following region: ENGPHLLVEAEQAKVFSHRGGNVTLPCKFYRDPTAFGSGIHKIRIKWTKL |
HAPLN1 Rabbit polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 165-354 of human HAPLN1 (NP_001875.1). |
| Modifications | Unmodified |
HAPLN1 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 165-354 of human HAPLN1 (NP_001875.1). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China
