Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit polyclonal HCK Antibody (N-term)
| Applications | FC, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This HCK antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 131-156 amino acids from the N-terminal region of human HCK. |
Rabbit Polyclonal Anti-HCK Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-HCK antibody is: synthetic peptide directed towards the C-terminal region of Human HCK. Synthetic peptide located within the following region: LVKLHAVVTKEPIYIITEFMAKGSLLDFLKSDEGSKQPLPKLIDFSAQIA |
Rabbit polyclonal HCK (Tyr521) antibody(Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human HCK around the phosphorylation site of tyrosine 521. |
| Modifications | Phospho-specific |
HCK rabbit polyclonal antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human HCK |
HCK Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 324-505 of human HCK (NP_001165600.1). |
| Modifications | Unmodified |
HCK Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 324-505 of human HCK (NP_001165600.1). |
| Modifications | Unmodified |
Active filters
Target Symbol
- HCK