HDAC4 rabbit polyclonal antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human HDAC4 |
HDAC4 rabbit polyclonal antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human HDAC4 |
Rabbit polyclonal HDAC4 (Ser632) antibody(Phospho-specific)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human HDAC4 around the phosphorylation site of serine 632 (A-Q-SP-S-P). |
Modifications | Phospho-specific |
Rabbit polyclonal HDAC4 (Ab-632) antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human HDAC4 around the phosphorylation site of serine 632. |
Rabbit polyclonal HDAC4 Antibody (C-term)
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | This HDAC4 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 1049-1077 amino acids from the C-terminal region of human HDAC4. |
Rabbit Polyclonal HDAC4 Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against A synthesized peptide derived from human HDAC4 |
Phospho-HDAC4-S632 Rabbit Polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | A phospho specific peptide corresponding to residues surrounding S632 of human HDAC4 |
Modifications | Phospho-specific |
Rabbit Polyclonal HDAC4 Antibody
Applications | ELISA |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | DNA immunization. This antibody is specific for the C Terminus Region of the target protein. |
Anti-HDAC4/HDAC5/HDAC9 (phospho-Ser246/259/220) Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide sequence around phosphorylation site of serine 246/259/220 (T-A-S(p)-EP) derived from Human HDAC4/HDAC5/HDAC9. |
Modifications | Phospho-specific |
Rabbit Polyclonal HDAC4 (Ser632) Antibody (Phospho-specific)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against A synthesized peptide derived from human HDAC4 around the phosphorylation site of Serine 632 |
Modifications | Phospho-specific |
Rabbit Polyclonal Anti-Hdac4 Antibody
Applications | Assay, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-Hdac4 Antibody is: synthetic peptide directed towards the C-terminal region of Mouse Hdac4. Synthetic peptide located within the following region: SSTVGHSLIEAQKCEKEEAETVTAMASLSVGVKPAEKRSEEEPMEEEPPL |
Mouse Monoclonal HDAC4 (N-terminus) Antibody
Applications | IP, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Rabbit anti-HDAC4 (Phospho-Ser632) polyclonal antibody(Phospho-specific)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized phosphopeptide derived from humanHDAC4 around the phosphorylation site of serine 632 (A-Q-SP-S-P). |
Modifications | Phospho-specific |
Carrier-free (BSA/glycerol-free) HDAC4 mouse monoclonal antibody, clone OTI1E1 (formerly 1E1)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) HDAC4 mouse monoclonal antibody, clone OTI1C8 (formerly 1C8)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) HDAC4 mouse monoclonal antibody, clone OTI1E12 (formerly 1E12)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) HDAC4 mouse monoclonal antibody, clone OTI1A12 (formerly 1A12)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) HDAC4 mouse monoclonal antibody, clone OTI4A4 (formerly 4A4)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) HDAC4 mouse monoclonal antibody, clone OTI6E6 (formerly 6E6)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) HDAC4 mouse monoclonal antibody, clone OTI7E1 (formerly 7E1)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) HDAC4 mouse monoclonal antibody, clone OTI4D7 (formerly 4D7)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Anti-HDAC4 Rabbit Polyclonal Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 536-548 amino acids of Human histone deacetylase 4 |
Anti-HDAC4 Rabbit Polyclonal Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 536-548 amino acids of Human histone deacetylase 4 |
HDAC4 rabbit polyclonal antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human HDAC4 |
HDAC4 Rabbit polyclonal Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 451-650 of human HDAC4 (NP_006028.2). |
Modifications | Unmodified |
HDAC4 Rabbit polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 451-650 of human HDAC4 (NP_006028.2). |
Modifications | Unmodified |
HDAC4 Rabbit polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human HDAC4 (NP_006028.2). |
Modifications | Unmodified |
HDAC4 mouse monoclonal antibody, clone OTI1E1 (formerly 1E1)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
HDAC4 mouse monoclonal antibody, clone OTI1E1 (formerly 1E1), Biotinylated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
HDAC4 mouse monoclonal antibody, clone OTI1E1 (formerly 1E1), HRP conjugated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
HDAC4 mouse monoclonal antibody, clone OTI1E1 (formerly 1E1)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
HDAC4 mouse monoclonal antibody, clone OTI1C8 (formerly 1C8)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
HDAC4 mouse monoclonal antibody, clone OTI1C8 (formerly 1C8), Biotinylated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
HDAC4 mouse monoclonal antibody, clone OTI1C8 (formerly 1C8), HRP conjugated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
HDAC4 mouse monoclonal antibody, clone OTI1C8 (formerly 1C8)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
HDAC4 mouse monoclonal antibody, clone OTI1E12 (formerly 1E12)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
HDAC4 mouse monoclonal antibody, clone OTI1E12 (formerly 1E12), Biotinylated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
HDAC4 mouse monoclonal antibody, clone OTI1E12 (formerly 1E12), HRP conjugated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
HDAC4 mouse monoclonal antibody, clone OTI1E12 (formerly 1E12)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
HDAC4 mouse monoclonal antibody, clone OTI1A12 (formerly 1A12)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
HDAC4 mouse monoclonal antibody, clone OTI1A12 (formerly 1A12), Biotinylated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
HDAC4 mouse monoclonal antibody, clone OTI1A12 (formerly 1A12), HRP conjugated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
HDAC4 mouse monoclonal antibody, clone OTI1A12 (formerly 1A12)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
HDAC4 mouse monoclonal antibody, clone OTI4A4 (formerly 4A4)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
HDAC4 mouse monoclonal antibody, clone OTI4A4 (formerly 4A4), Biotinylated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
HDAC4 mouse monoclonal antibody, clone OTI4A4 (formerly 4A4), HRP conjugated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
HDAC4 mouse monoclonal antibody, clone OTI4A4 (formerly 4A4)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
HDAC4 mouse monoclonal antibody, clone OTI6E6 (formerly 6E6)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
HDAC4 mouse monoclonal antibody, clone OTI6E6 (formerly 6E6), Biotinylated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
HDAC4 mouse monoclonal antibody, clone OTI6E6 (formerly 6E6), HRP conjugated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
HDAC4 mouse monoclonal antibody, clone OTI6E6 (formerly 6E6)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |