Germany
Japan
United Kingdom
China
HEPACAM (C-term) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human |
| Immunogen | KLH conjugated synthetic peptide between 305-335 amino acids from the C-terminal region of human HEPACAM |
Antibodies
View as table Download
Rabbit polyclonal Anti-HEPACAM Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-HEPACAM antibody: synthetic peptide directed towards the N terminal of human HEPACAM. Synthetic peptide located within the following region: LLLSDLQLADEGTYEVEISITDDTFTGEKTINLTVDVPISRPQVLVASTT |
HEPACAM Antibody - N-terminal region
| Applications | WB |
| Reactivities | Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the N-terminal region of Rat RGD1306811 |
HEPACAM Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 35-245 of human HEPACAM (NP_689935.2). |
| Modifications | Unmodified |
Active filters
Target Symbol
- HEPACAM