Antibodies

Jump to Filters
View as table Download
Hephaestin (HEPH) Rabbit Polyclonal Antibody
TA341959

USD 375.00

5 Days

Rabbit Polyclonal Anti-HEPH Antibody

Applications WB
Reactivities Human
Immunogen The immunogen for anti-HEPH antibody: synthetic peptide directed towards the N terminal of human HEPH. Synthetic peptide located within the following region: MHAINGFVFGNLPELNMCAQKRVAWHLFGMGNEIDVHTAFFHGQMLTTRG
HEPH Rabbit Polyclonal Antibody
TA366621

USD 380.00

4 Weeks

HEPH rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human HEPH
HEPH Rabbit Polyclonal Antibody
TA370972

USD 380.00

4 Weeks

HEPH rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human HEPH