Germany
Japan
United Kingdom
China
Goat Anti-HES4 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-RSAAEHRKVGSRP, from the internal region of the protein sequence according to NP_001135939.1. |
Antibodies
View as table Download
Rabbit Polyclonal Anti-HES4 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-HES4 antibody: synthetic peptide directed towards the N terminal of human HES4. Synthetic peptide located within the following region: MAADTPGKPSASPMAGAPASASRTPDKPRSAAEHRKSSKPVMEKRRRARI |
Rabbit Polyclonal Anti-HES4 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-HES4 antibody: synthetic peptide directed towards the middle region of human HES4. Synthetic peptide located within the following region: GHLAACLRQLGPSRRPASLSPAAPAEAPAPEVYAGRPLLPSLGGPFPLLA |
Active filters
Target Symbol
- HES4