Antibodies

Jump to Filters
View as table Download
HEXIM1 Rabbit Polyclonal Antibody
TA349449

USD 380.00

In Stock

Rabbit Polyclonal Anti-HEXIM1 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human HEXIM1
HEXIM1 Rabbit Polyclonal Antibody
TA347668

USD 380.00

4 Weeks

Rabbit Polyclonal Anti-HEXIM1 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-HEXIM1 Antibody: A synthesized peptide derived from human HEXIM1
HEXIM1 Rabbit Polyclonal Antibody
TA332907

USD 275.00

3 Weeks

Rabbit anti-HEXIM1 Polyclonal Antibody

Applications WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human HEXIM1
HEXIM1 (Center) Rabbit Polyclonal Antibody
AP52035PU-N

USD 450.00

2 Weeks

HEXIM1 (Center) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human, Mouse
Immunogen KLH conjugated synthetic peptide between 201-230 amino acids from the Central region of human HEXIM1
HEXIM1 Rabbit Polyclonal Antibody
TA312801

USD 345.00

4 Weeks

Rabbit polyclonal anti-HES7 (HEXIM1) antibody

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from Internal of human HES7.
HEXIM1 Goat Polyclonal Antibody
TA303065

USD 375.00

5 Days

Goat Polyclonal Antibody against HEXIM1

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-HRQQERAPLSKFGD, from the C Terminus of the protein sequence according to NP_006451.1.
HEXIM1 Rabbit Polyclonal Antibody
TA335686

USD 310.00

5 Days

Rabbit Polyclonal Anti-HEXIM1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-HEXIM1 Antibody: synthetic peptide directed towards the C terminal of human HEXIM1. Synthetic peptide located within the following region: LESKRLGGDDARVRELELELDRLRAENLQLLTENELHRQQERAPLSKFGD
HEXIM1 Rabbit Polyclonal Antibody
TA322498

USD 345.00

In Stock

Anti-HEXIM1 Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from C terminal 250 amino acids of human ?
HEXIM1 Rabbit Polyclonal Antibody
TA384406

USD 380.00

4 Weeks

HEXIM1 Rabbit polyclonal Antibody

Applications ELISA, IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from human HEXIM1. AA range:181-230