Rabbit Polyclonal Anti-HEY1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-HEY1 antibody: synthetic peptide directed towards the middle region of human HEY1. Synthetic peptide located within the following region: HQGRLGSAHPEAPALRAPPSGSLGPVLPVVTSASKLSPPLLSSVASLSAF |
Rabbit Polyclonal Anti-HEY1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-HEY1 antibody is: synthetic peptide directed towards the N-terminal region of Human HEY1. Synthetic peptide located within the following region: SSALGSMSPTTSSQILARKRRRGIIEKRRRDRINNSLSELRRLVPSAFEK |
Rabbit Polyclonal Anti-HEY1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-HEY1 antibody: synthetic peptide directed towards the N terminal of human HEY1. Synthetic peptide located within the following region: ALGSMSPTTSSQILARKRRRGIIEKRRRDRINNSLSELRRLVPSAFEKQG |
Rabbit Polyclonal Anti-HEY1 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-HEY1 antibody is: synthetic peptide directed towards the C-terminal region of Human HEY1. Synthetic peptide located within the following region: PQNGHGNAGTTASPTEPHHQGRLGSAHPEAPALRAPPSGSFGPVLPVVTS |
Rabbit Polyclonal HEY1 Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | A portion of amino acids 50-100 of mouse Hey1 was used as the immunogen. |
Hey1 Antibody - C-terminal region
| Applications | WB |
| Reactivities | Rat |
| Conjugation | Unconjugated |
HEY1 Rabbit polyclonal Antibody
| Applications | IF, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide corresponding to a sequence within amino acids 50-150 of human HEY1 (NP_001269780.1). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China
