Antibodies

Jump to Filters
View as table Download
HHAT Rabbit Polyclonal Antibody
TA342360

USD 375.00

5 Days

Rabbit Polyclonal Anti-HHAT Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-HHAT antibody: synthetic peptide directed towards the N terminal of human HHAT. Synthetic peptide located within the following region: MLPRWELALYLLASLGFHFYSFYEVYKVSREHEEELDQEFELETDTLFGG
HHAT Rabbit Polyclonal Antibody
TA377013

USD 220.00

3 Weeks

HHAT Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human HHAT (NP_060664.2).
Modifications Unmodified