Antibodies

View as table Download

Rabbit anti-HFE2 Polyclonal Antibody

Applications WB
Reactivities Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human HFE2

Repulsive Guidance Molecule C (HFE2) (C-term) rabbit polyclonal antibody, Aff - Purified

Applications FC, WB
Reactivities Human
Immunogen This HFE2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 308-338 amino acids from the C-terminal region of human HFE2.

Repulsive Guidance Molecule C (HFE2) (Center) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human, Mouse
Immunogen KLH conjugated synthetic peptide between 141~170 amino acids from the Central region of Human HFE2 / Hemojuvelin

Rabbit Polyclonal Anti-HFE2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-HFE2 antibody: synthetic peptide directed towards the N terminal of human HFE2. Synthetic peptide located within the following region: SSLSIQTANPGNHVEIQAAYIGTTIIIRQTAGQLSFSIKVAEDVAMAFSA