Rabbit polyclonal HK2 (Hexokinase II) Antibody (Center)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This HK2 (Hexokinase II) antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 453-483 amino acids from the Central region of human HK2 (Hexokinase II). |
Rabbit polyclonal HK2 (Hexokinase II) Antibody (N-term)
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This HK2 (Hexokinase II) antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 91-121 amino acids from the N-terminal region of human HK2 (Hexokinase II). |
Rabbit Polyclonal Anti-HK2 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-HK2 Antibody: synthetic peptide directed towards the N terminal of human HK2. Synthetic peptide located within the following region: GTEHGEFLALDLGGTNFRVLWVKVTDNGLQKVEMENQIYAIPEDIMRGSG |
Rabbit Polyclonal Anti-HK2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-HK2 Antibody: synthetic peptide directed towards the middle region of human HK2. Synthetic peptide located within the following region: QRIKENKGEERLRSTIGVDGSVYKKHPHFAKRLHKTVRRLVPGCDVRFLR |
Mouse Monoclonal Hexokinase II Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
USD 420.00
4 Weeks
USD 420.00
4 Weeks
USD 420.00
4 Weeks
Germany
Japan
United Kingdom
China
