Antibodies

Jump to Filters
View as table Download
HLAA (HLA-A) Rabbit Polyclonal Antibody
TA332507

USD 275.00

3 Weeks

Rabbit anti-HLA-A Polyclonal Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant protein of human HLA-A
HLAA (HLA-A) Rabbit Polyclonal Antibody
TA372501

USD 380.00

4 Weeks

HLA-A rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide of human HLA-A
HLAA (HLA-A) Rabbit Polyclonal Antibody
TA343265

USD 375.00

5 Days

Rabbit Polyclonal Anti-HLA-A Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-HLA-A antibody is: synthetic peptide directed towards the N-terminal region of Human HLA-A. Synthetic peptide located within the following region: SDAASQRMEPRAPWIEQEGPEYWDQETRNVKAQSQTDRVDLGTLRGYYNQ
HLAA (HLA-A) Mouse Monoclonal Antibody [Clone ID: BB7.2]
TA353219L

USD 1,140.00

2 Weeks

Mouse monoclonal Anti-HLA-A2 Clone BB7.2

Reactivities Human
Conjugation Unconjugated
HLAA (HLA-A) Mouse Monoclonal Antibody [Clone ID: OTI4D11]
CF813375

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) HLA mouse monoclonal antibody, clone OTI4D11

Applications WB
Reactivities Human
Conjugation Unconjugated
HLAA (HLA-A) Mouse Monoclonal Antibody [Clone ID: OTI2D11]
CF813378

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) HLA mouse monoclonal antibody, clone OTI2D11

Applications WB
Reactivities Human
Conjugation Unconjugated
HLAA (HLA-A) Mouse Monoclonal Antibody [Clone ID: OTI3H6]
CF813379

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) HLA mouse monoclonal antibody, clone OTI3H6

Applications WB
Reactivities Human
Conjugation Unconjugated
HLAA (HLA-A) Rabbit Polyclonal Antibody
TA360118

USD 360.00

5 Days

HLA-A Antibody - C-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the C terminal region of human HLA-A
HLAA (HLA-A) Rabbit Polyclonal Antibody
TA377096

USD 220.00

3 Weeks

HLA-A Rabbit polyclonal Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen A synthetic peptide of Human HLA-A .
Modifications Unmodified
HLAA (HLA-A) Rabbit Polyclonal Antibody
TA384433

USD 380.00

4 Weeks

HLA A Rabbit polyclonal Antibody

Applications ELISA, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from human HLA Class I. AA range:204-253
HLA-A Rabbit Polyclonal Antibody
TA384434

USD 380.00

4 Weeks

MHC Class I Rabbit polyclonal Antibody

Applications FC, IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen A synthesized peptide derived from human MHC class I
HLA-A Rabbit Monoclonal Antibody [Clone ID: R02-5C6]
TA384435

USD 380.00

4 Weeks

MHC Class I Rabbit monoclonal Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated