Rabbit Polyclonal anti-Hlf Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-Hlf antibody is: synthetic peptide directed towards the N-terminal region of Mouse Hlf. Synthetic peptide located within the following region: MEKMSRQLPLNPTFIPPPYGVLRSLLENPLKLPLHPEDAFSKEKDKGKKL |
Rabbit Polyclonal Anti-HLF Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-HLF antibody: synthetic peptide directed towards the C terminal of human HLF. Synthetic peptide located within the following region: NNMAAKRSRDARRLKENQIAIRASFLEKENSALRQEVADLRKELGKCKNI |
HLF Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-295 of human HLF (NP_002117.1). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China