Goat Anti-HMGA1 Antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-LASKQEKDGTEK, from the internal region of the protein sequence according to NP_665906.1; NP_665908.1; NP_002122.1; NP_665909.1; NP_665912.1; NP_665910.1. |
HMGA1 (9-21) goat polyclonal antibody, Aff - Purified
| Applications | ELISA, IHC, WB |
| Reactivities | Bat, Canine, Equine, Hamster, Human, Monkey, Mouse, Porcine, Rabbit, Rat |
| Immunogen | HMGA1 antibody was raised against peptide from the internal region (near N Terminus) of human HMGA1. |
Rabbit polyclonal HMGA1 Antibody (C-term)
| Applications | FC, IF, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This HMGA1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 64-93 amino acids from the C-terminal region of human HMGA1. |
Goat Anti-HMGA1 (aa9-21) Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-SQPLASKQEKDGT, from the internal region (near N Terminus) of the protein sequence according to NP_665906.1; NP_002122.1. |
Rabbit Polyclonal Anti-HMGA1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-HMGA1 Antibody: synthetic peptide directed towards the N terminal of human HMGA1. Synthetic peptide located within the following region: MSESSSKSSQPLASKQEKDGTEKRGRGRPRKQPPKEPSEVPTPKRPRGRP |
Rabbit Polyclonal Anti-Hmga1 Antibody
| Applications | WB |
| Reactivities | Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Hmga1 antibody is: synthetic peptide directed towards the N-terminal region of Rat Hmga1. Synthetic peptide located within the following region: MSESGSKSSQPLASKQEKDGTEKRGRGRPRKQPSVSPGTALVGSQKEPSE |
Anti-HMGA1 Rabbit Polyclonal Antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 12-24 amino acids of Human high mobility group AT-hook 1 |
Anti-HMGA1 Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 12-24 amino acids of Human high mobility group AT-hook 1 |
HMGA1 Antibody - N-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the N-terminal region of Human HMGA1 |
HMGA1 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human HMGA1 (NP_665908.1). |
| Modifications | Unmodified |
HMGA1 Rabbit polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human HMGA1 (NP_665908.1). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China
