Rabbit Polyclonal Anti-HNF1A Antibody - N-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-HNF1A antibody: synthetic peptide directed towards the N terminal of human HNF1A. Synthetic peptide located within the following region: HAGQGGLIEEPTGDELPTKKGRRNRFKWGPASQQILFQAYERQKNPSKEE |
Goat Polyclonal Anti-cardiac troponin T (aa201-213) Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Pig (Expected from sequence similarity: Feline, Rat, Dog, Cow) |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-cardiac troponin T (aa201-213) Antibody: Peptide with sequence C-TERKSGKRQTERE, from the internal region of the protein sequence according to NP_000355.2; NP_001001430.1; NP_001001431.1; NP_001001432.1. |
HNF1A rabbit polyclonal antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human HNF1A |
Anti-HNF1A Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 57-70 amino acids of human HNF1 homeobox A |
Rabbit Polyclonal Anti-HNF1A
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-HNF1A antibody: synthetic peptide directed towards the N terminal of human HNF1A. Synthetic peptide located within the following region: HAGQGGLIEEPTGDELPTKKGRRNRFKWGPASQQILFQAYERQKNPSKEE |
Rabbit polyclonal HNF1A Antibody (Center)
| Applications | IF, WB |
| Reactivities | Human, Mouse (Predicted: Rat) |
| Conjugation | Unconjugated |
| Immunogen | This HNF1A antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 177-205 amino acids from the Central region of human HNF1A. |
Rabbit Polyclonal anti-HNF1A Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-HNF1A antibody is: synthetic peptide directed towards the C-terminal region of Human HNF1A. Synthetic peptide located within the following region: QTMLITDTTNLSALASLTPTKQVFTSDTEASSESGLHTPASQATTLHVPS |
HNF1A Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human HNF1A |
HNF1A rabbit polyclonal antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human HNF1A |
Germany
Japan
United Kingdom
China
