Rabbit anti-HNMT Polyclonal Antibody
Applications | ICC/IF, IP, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human HNMT |
Rabbit anti-HNMT Polyclonal Antibody
Applications | ICC/IF, IP, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human HNMT |
Rabbit polyclonal HNMT Antibody (N-term)
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | This HNMT antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 29-58 amino acids from the N-terminal region of human HNMT. |
Rabbit Polyclonal Anti-HNMT Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-HNMT antibody: synthetic peptide directed towards the N terminal of human HNMT. Synthetic peptide located within the following region: PGIIGRIGDTKSEIKILSIGGGAGEIDLQILSKVQAQYPGVCINNEVVEP |
HNMT Antibody - C-terminal region
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen is a synthetic peptide directed towards the C-terminal region of Human HNMT |
HNMT Antibody - middle region
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human HNMT |
HNMT Rabbit polyclonal Antibody
Applications | IP, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-292 of human HNMT (NP_008826.1). |
Modifications | Unmodified |