Antibodies

Jump to Filters

View as table

Loading...

Download Close

Download

1 - 30 of 30 results

(reset)

HNRPH1 (HNRNPH1) Rabbit Polyclonal Antibody

TA344321

USD 475.00

5 Days

Rabbit Polyclonal Anti-HNRPH1 Antibody - middle region

Applications	IF, IHC, IP, WB
Reactivities	Human
Conjugation	Unconjugated
Immunogen	The immunogen for anti-HNRPH1 antibody: synthetic peptide directed towards the middle region of human HNRPH1. Synthetic peptide located within the following region: FLNSTAGASGGAYEHRYVELFLNSTAGASGGAYGSQMMGGMGLSNQSSYG

1 / 8

2 / 8

3 / 8

4 / 8

5 / 8

6 / 8

7 / 8

8 / 8

Previous Next

HNRPH1 (HNRNPH1) Rabbit Polyclonal Antibody

TA371373

USD 380.00

4 Weeks

HNRNPH1 rabbit polyclonal antibody

Applications	WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated
Immunogen	Synthetic peptide of human HNRNPH1

HNRPH1 (HNRNPH1) Rabbit Polyclonal Antibody

AP20424PU-N

USD 407.00

2 Weeks

HNRPH1 (HNRNPH1) rabbit polyclonal antibody, Aff - Purified

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

1 / 2

2 / 2

Previous Next

HNRPH1 (HNRNPH1) Mouse Monoclonal Antibody [Clone ID: OTI2E8]

CF810861

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) HNRNPH1 mouse monoclonal antibody,clone OTI2E8

Applications	IHC, WB
Reactivities	Human, Mouse
Conjugation	Unconjugated

• 

1 / 11

2 / 11

3 / 11

4 / 11

5 / 11

6 / 11

7 / 11

8 / 11

9 / 11

10 / 11

11 / 11

Previous Next

HNRPH1 (HNRNPH1) Mouse Monoclonal Antibody [Clone ID: OTI2D11]

CF810866

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) HNRNPH1 mouse monoclonal antibody,clone OTI2D11

Applications	IHC, WB
Reactivities	Human, Mouse
Conjugation	Unconjugated

• 

1 / 12

2 / 12

3 / 12

4 / 12

5 / 12

6 / 12

7 / 12

8 / 12

9 / 12

10 / 12

11 / 12

12 / 12

Previous Next

HNRPH1 (HNRNPH1) Mouse Monoclonal Antibody [Clone ID: OTI5D11]

CF810894

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) HNRNPH1 mouse monoclonal antibody,clone OTI5D11

Applications	IHC, WB
Reactivities	Human, Mouse
Conjugation	Unconjugated

• 

1 / 14

2 / 14

3 / 14

4 / 14

5 / 14

6 / 14

7 / 14

8 / 14

9 / 14

10 / 14

11 / 14

12 / 14

13 / 14

14 / 14

Previous Next

HNRPH1 (HNRNPH1) Mouse Monoclonal Antibody [Clone ID: OTI1H3]

CF810901

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) HNRNPH1 mouse monoclonal antibody,clone OTI1H3

Applications	IHC, WB
Reactivities	Human, Mouse
Conjugation	Unconjugated

• 

1 / 11

2 / 11

3 / 11

4 / 11

5 / 11

6 / 11

7 / 11

8 / 11

9 / 11

10 / 11

11 / 11

Previous Next

HNRPH1 (HNRNPH1) Mouse Monoclonal Antibody [Clone ID: OTI4F10]

CF810906

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) HNRNPH1 mouse monoclonal antibody,clone OTI4F10

Applications	IHC, WB
Reactivities	Human, Mouse
Conjugation	Unconjugated

• 

1 / 11

2 / 11

3 / 11

4 / 11

5 / 11

6 / 11

7 / 11

8 / 11

9 / 11

10 / 11

11 / 11

Previous Next

HNRPH1 (HNRNPH1) Rabbit Polyclonal Antibody

TA351254

USD 345.00

In Stock

Rabbit Polyclonal Anti-HNRNPH1 Antibody

Applications	WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated
Immunogen	Synthetic peptide of human HNRNPH1

HNRPH1 (HNRNPH1) Rabbit Polyclonal Antibody

TA377166

USD 220.00

3 Weeks

HNRNPH1 Rabbit polyclonal Antibody

Applications	IF, IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated
Immunogen	A synthetic peptide of human HNRNPH1
Modifications	Unmodified

HNRPH1 (HNRNPH1) Mouse Monoclonal Antibody [Clone ID: OTI2E8]

TA810861

USD 379.00

In Stock

HNRNPH1 mouse monoclonal antibody,clone OTI2E8

Applications	IHC, WB
Reactivities	Human, Mouse
Conjugation	Unconjugated

• 

1 / 11

2 / 11

3 / 11

4 / 11

5 / 11

6 / 11

7 / 11

8 / 11

9 / 11

10 / 11

11 / 11

Previous Next

HNRPH1 (HNRNPH1) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI2E8]

TA810861AM

USD 420.00

4 Weeks

HNRNPH1 mouse monoclonal antibody,clone OTI2E8, Biotinylated

Applications	IHC, WB
Reactivities	Human, Mouse
Conjugation	Biotin

• 

1 / 11

2 / 11

3 / 11

4 / 11

5 / 11

6 / 11

7 / 11

8 / 11

9 / 11

10 / 11

11 / 11

Previous Next

HNRPH1 (HNRNPH1) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI2E8]

TA810861BM

USD 420.00

4 Weeks

HNRNPH1 mouse monoclonal antibody,clone OTI2E8, HRP conjugated

Applications	IHC, WB
Reactivities	Human, Mouse
Conjugation	HRP

• 

1 / 11

2 / 11

3 / 11

4 / 11

5 / 11

6 / 11

7 / 11

8 / 11

9 / 11

10 / 11

11 / 11

Previous Next

HNRPH1 (HNRNPH1) Mouse Monoclonal Antibody [Clone ID: OTI2E8]

TA810861S

USD 159.00

2 Days

HNRNPH1 mouse monoclonal antibody,clone OTI2E8

Applications	IHC, WB
Reactivities	Human, Mouse
Conjugation	Unconjugated

• 

1 / 11

2 / 11

3 / 11

4 / 11

5 / 11

6 / 11

7 / 11

8 / 11

9 / 11

10 / 11

11 / 11

Previous Next

HNRPH1 (HNRNPH1) Mouse Monoclonal Antibody [Clone ID: OTI2D11]

TA810866

USD 379.00

In Stock

HNRNPH1 mouse monoclonal antibody,clone OTI2D11

Applications	IHC, WB
Reactivities	Human, Mouse
Conjugation	Unconjugated

• 

1 / 12

2 / 12

3 / 12

4 / 12

5 / 12

6 / 12

7 / 12

8 / 12

9 / 12

10 / 12

11 / 12

12 / 12

Previous Next

HNRPH1 (HNRNPH1) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI2D11]

TA810866AM

USD 420.00

4 Weeks

HNRNPH1 mouse monoclonal antibody,clone OTI2D11, Biotinylated

Applications	IHC, WB
Reactivities	Human, Mouse
Conjugation	Biotin

• 

1 / 12

2 / 12

3 / 12

4 / 12

5 / 12

6 / 12

7 / 12

8 / 12

9 / 12

10 / 12

11 / 12

12 / 12

Previous Next

HNRPH1 (HNRNPH1) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI2D11]

TA810866BM

USD 420.00

4 Weeks

HNRNPH1 mouse monoclonal antibody,clone OTI2D11, HRP conjugated

Applications	IHC, WB
Reactivities	Human, Mouse
Conjugation	HRP

• 

1 / 12

2 / 12

3 / 12

4 / 12

5 / 12

6 / 12

7 / 12

8 / 12

9 / 12

10 / 12

11 / 12

12 / 12

Previous Next

HNRPH1 (HNRNPH1) Mouse Monoclonal Antibody [Clone ID: OTI2D11]

TA810866S

USD 159.00

2 Days

HNRNPH1 mouse monoclonal antibody,clone OTI2D11

Applications	IHC, WB
Reactivities	Human, Mouse
Conjugation	Unconjugated

• 

1 / 12

2 / 12

3 / 12

4 / 12

5 / 12

6 / 12

7 / 12

8 / 12

9 / 12

10 / 12

11 / 12

12 / 12

Previous Next

HNRPH1 (HNRNPH1) Mouse Monoclonal Antibody [Clone ID: OTI5D11]

TA810894

USD 379.00

In Stock

HNRNPH1 mouse monoclonal antibody,clone OTI5D11

Applications	IHC, WB
Reactivities	Human, Mouse
Conjugation	Unconjugated

• 

1 / 14

2 / 14

3 / 14

4 / 14

5 / 14

6 / 14

7 / 14

8 / 14

9 / 14

10 / 14

11 / 14

12 / 14

13 / 14

14 / 14

Previous Next

HNRPH1 (HNRNPH1) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI5D11]

TA810894AM

USD 420.00

4 Weeks

HNRNPH1 mouse monoclonal antibody,clone OTI5D11, Biotinylated

Applications	IHC, WB
Reactivities	Human, Mouse
Conjugation	Biotin

• 

1 / 14

2 / 14

3 / 14

4 / 14

5 / 14

6 / 14

7 / 14

8 / 14

9 / 14

10 / 14

11 / 14

12 / 14

13 / 14

14 / 14

Previous Next

HNRPH1 (HNRNPH1) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI5D11]

TA810894BM

USD 420.00

4 Weeks

HNRNPH1 mouse monoclonal antibody,clone OTI5D11, HRP conjugated

Applications	IHC, WB
Reactivities	Human, Mouse
Conjugation	HRP

• 

1 / 14

2 / 14

3 / 14

4 / 14

5 / 14

6 / 14

7 / 14

8 / 14

9 / 14

10 / 14

11 / 14

12 / 14

13 / 14

14 / 14

Previous Next

HNRPH1 (HNRNPH1) Mouse Monoclonal Antibody [Clone ID: OTI5D11]

TA810894S

USD 159.00

2 Days

HNRNPH1 mouse monoclonal antibody,clone OTI5D11

Applications	IHC, WB
Reactivities	Human, Mouse
Conjugation	Unconjugated

• 

1 / 14

2 / 14

3 / 14

4 / 14

5 / 14

6 / 14

7 / 14

8 / 14

9 / 14

10 / 14

11 / 14

12 / 14

13 / 14

14 / 14

Previous Next

HNRPH1 (HNRNPH1) Mouse Monoclonal Antibody [Clone ID: OTI1H3]

TA810901

USD 379.00

In Stock

HNRNPH1 mouse monoclonal antibody,clone OTI1H3

Applications	IHC, WB
Reactivities	Human, Mouse
Conjugation	Unconjugated

• 

1 / 11

2 / 11

3 / 11

4 / 11

5 / 11

6 / 11

7 / 11

8 / 11

9 / 11

10 / 11

11 / 11

Previous Next

HNRPH1 (HNRNPH1) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1H3]

TA810901AM

USD 420.00

4 Weeks

HNRNPH1 mouse monoclonal antibody,clone OTI1H3, Biotinylated

Applications	IHC, WB
Reactivities	Human, Mouse
Conjugation	Biotin

• 

1 / 11

2 / 11

3 / 11

4 / 11

5 / 11

6 / 11

7 / 11

8 / 11

9 / 11

10 / 11

11 / 11

Previous Next

HNRPH1 (HNRNPH1) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1H3]

TA810901BM

USD 420.00

4 Weeks

HNRNPH1 mouse monoclonal antibody,clone OTI1H3, HRP conjugated

Applications	IHC, WB
Reactivities	Human, Mouse
Conjugation	HRP

• 

1 / 11

2 / 11

3 / 11

4 / 11

5 / 11

6 / 11

7 / 11

8 / 11

9 / 11

10 / 11

11 / 11

Previous Next

HNRPH1 (HNRNPH1) Mouse Monoclonal Antibody [Clone ID: OTI1H3]

TA810901S

USD 159.00

2 Days

HNRNPH1 mouse monoclonal antibody,clone OTI1H3

Applications	IHC, WB
Reactivities	Human, Mouse
Conjugation	Unconjugated

• 

1 / 11

2 / 11

3 / 11

4 / 11

5 / 11

6 / 11

7 / 11

8 / 11

9 / 11

10 / 11

11 / 11

Previous Next

HNRPH1 (HNRNPH1) Mouse Monoclonal Antibody [Clone ID: OTI4F10]

TA810906

USD 379.00

In Stock

HNRNPH1 mouse monoclonal antibody,clone OTI4F10

Applications	IHC, WB
Reactivities	Human, Mouse
Conjugation	Unconjugated

• 

1 / 11

2 / 11

3 / 11

4 / 11

5 / 11

6 / 11

7 / 11

8 / 11

9 / 11

10 / 11

11 / 11

Previous Next

HNRPH1 (HNRNPH1) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI4F10]

TA810906AM

USD 420.00

4 Weeks

HNRNPH1 mouse monoclonal antibody,clone OTI4F10, Biotinylated

Applications	IHC, WB
Reactivities	Human, Mouse
Conjugation	Biotin

• 

1 / 11

2 / 11

3 / 11

4 / 11

5 / 11

6 / 11

7 / 11

8 / 11

9 / 11

10 / 11

11 / 11

Previous Next

HNRPH1 (HNRNPH1) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI4F10]

TA810906BM

USD 420.00

4 Weeks

HNRNPH1 mouse monoclonal antibody,clone OTI4F10, HRP conjugated

Applications	IHC, WB
Reactivities	Human, Mouse
Conjugation	HRP

• 

1 / 11

2 / 11

3 / 11

4 / 11

5 / 11

6 / 11

7 / 11

8 / 11

9 / 11

10 / 11

11 / 11

Previous Next

HNRPH1 (HNRNPH1) Mouse Monoclonal Antibody [Clone ID: OTI4F10]

TA810906S

USD 159.00

2 Days

HNRNPH1 mouse monoclonal antibody,clone OTI4F10

Applications	IHC, WB
Reactivities	Human, Mouse
Conjugation	Unconjugated

• 

1 / 11

2 / 11

3 / 11

4 / 11

5 / 11

6 / 11

7 / 11

8 / 11

9 / 11

10 / 11

11 / 11

Previous Next

1 - 30 of 30 results