Rabbit polyclonal HOMEZ Antibody (N-term)
| Applications | FC, IF, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | This HOMEZ antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 158-186 amino acids from the N-terminal region of human HOMEZ. |
Rabbit polyclonal Anti-HOMEZ Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-HOMEZ antibody: synthetic peptide directed towards the N terminal of mouse HOMEZ. Synthetic peptide located within the following region: LSPLAPSEQPTHMKGLKVEPEEPSQVSQLPLNHQNAKEPLMMGSRTFSHQ |
Rabbit Polyclonal Anti-HOMEZ Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-HOMEZ antibody: synthetic peptide directed towards the middle region of human HOMEZ. Synthetic peptide located within the following region: QDPAIPTPPPSTRSLNERAETPPLPIPPPPPDIQPLERYWAAHQQLRETD |
Rabbit Polyclonal Anti-HOMEZ Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-HOMEZ antibody: synthetic peptide directed towards the N terminal of human HOMEZ. Synthetic peptide located within the following region: KTFSYFPYPSLADIALLCLRYGLQMEKVKTWFMAQRLRCGISWSSEEIEE |
Germany
Japan
United Kingdom
China
