Antibodies

View as table Download

Rabbit Polyclonal Anti-HOXA5 Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-HOXA5 antibody: synthetic peptide directed towards the C terminal of human HOXA5. Synthetic peptide located within the following region: FNRYLTRRRRIEIAHALCLSERQIKIWFQNRRMKWKKDNKLKSMSMAAAG

HOXA5 rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human HOXA5

Goat Polyclonal Anti-HOXA5 (aa83-92) Antibody

Applications WB
Reactivities Human, Mouse, Rat, Pig (Expected from sequence similarity: Cow)
Conjugation Unconjugated
Immunogen The immunogen for Anti-HOXA5 (aa83-92) Antibody: Peptide with sequence C-EPRYSQPATS, from the internal region of the protein sequence according to NP_061975.2.

Rabbit Polyclonal HOXA5 Antibody

Applications ELISA, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen DNA immunization. This antibody is specific for the Middle Region of the target protein.

Goat Polyclonal Anti-HOXA5 (aa157-168) Antibody

Applications WB
Reactivities Pig (Expected from sequence similarity: Human, Cow)
Conjugation Unconjugated
Immunogen The immunogen for Anti-HOXA5 (aa157-168) Antibody: Peptide with sequence C-SEQASAQSEPSP, from the internal region of the protein sequence according to NP_061975.2.

Rabbit polyclonal anti-HXA5 antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from N-terminal of human HXA5.

Rabbit Polyclonal anti-HOXA5 antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-HOXA5 antibody: synthetic peptide directed towards the middle region of human HOXA5. Synthetic peptide located within the following region: VGTASGAEEDAPASSEQASAQSEPSPAPPAQPQIYPWMRKLHISHDNIGG

HOXA5 (C-term) rabbit polyclonal antibody

Applications WB
Reactivities Human, Mouse
Immunogen KLH conjugated synthetic peptide selected from the C-terminal region of human HOXA5