Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit polyclonal HOXA1/B1/D1 antibody
| Applications | IHC |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human HOXA1/B1/D1. |
Rabbit Polyclonal anti-Hoxb1 antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Hoxb1 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: ETQVKIWFQNRRMKQKKREREGGRMPAGPPGCPKEAAGDASDQSACTSPE |
Rabbit Polyclonal Anti-HOXB1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-HOXB1 Antibody: synthetic peptide directed towards the C terminal of human HOXB1. Synthetic peptide located within the following region: FQNRRMKQKKREREEGRVPPAPPGCPKEAAGDASDQSTCTSPEASPSSVT |
Rabbit Polyclonal Anti-Hoxb1 Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Hoxb1 antibody: synthetic peptide directed towards the N terminal of mouse Hoxb1. Synthetic peptide located within the following region: QQPPSSLGVSFPSPAPSGYAPAACNPSYGPSQYYSVGQSEGDGSYFHPSS |
Rabbit Polyclonal Anti-HOXB1 Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-HOXB1 antibody: synthetic peptide directed towards the N terminal of mouse HOXB1. Synthetic peptide located within the following region: TSFPPCSAPAVDSYAGESRYGGGLPSSALQQNSGYPVQQPPSSLGVSFPS |
Hoxb1 Antibody - N-terminal region
| Applications | WB |
| Reactivities | Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the N-terminal region of Rat Hoxb1 |
HOXB1 Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of Human HOXB1 |
HOXB1 Antibody - middlel region
| Applications | WB |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of mouse HOXB1 |
HOXB1 rabbit polyclonal antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human HOXB1 |
HOXB1 Rabbit polyclonal Antibody
| Applications | IF, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 35-180 of human HOXB1 (NP_002135.2). |
| Modifications | Unmodified |
Active filters
Target Symbol
- HOXB1