Germany
Japan
United Kingdom
China
Rabbit Polyclonal Anti-HOXB13 Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human HOXB13 |
Antibodies
View as table Download
Goat Polyclonal Antibody against HOXB13
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-KKVLAKVKNSATP, from the C Terminus of the protein sequence according to NP_006352.2. |
Rabbit Polyclonal Anti-Hoxb13 Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Hoxb13 antibody: synthetic peptide directed towards the n terminal of mouse Hoxb13. Synthetic peptide located within the following region: MEPGNYATLDGAKDIEGLLGAGGGRNLVSHSSPLASHPAAPTLMPTVNYA |
Rabbit Polyclonal Anti-HOXB13 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-HOXB13 antibody: synthetic peptide directed towards the middle region of mouse HOXB13. Synthetic peptide located within the following region: GYFGGGYYSCRVSRSSLKPCAQTAALATYPSETPAPGEEYPSRPTEFAFY |
HOXB13 rabbit polyclonal antibody
| Applications | ELISA, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human HOXB13 |
HOXB13 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide corresponding to a sequence within amino acids 50-150 of human HOXB13 (NP_006352.2). |
| Modifications | Unmodified |
Active filters
Target Symbol
- HOXB13