Antibodies

Jump to Filters
View as table Download
HPGDS Rabbit Polyclonal Antibody
TA346774

USD 475.00

5 Days

Rabbit Polyclonal Anti-PGDS Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PGDS antibody: synthetic peptide directed towards the N terminal of human PGDS. Synthetic peptide located within the following region: EQADWPEIKSTLPFGKIPILEVDGLTLHQSLAIARYLTKNTDLAGNTEME
HPGDS Rabbit Polyclonal Antibody
TA346773

USD 475.00

5 Days

Rabbit Polyclonal Anti-PGDS Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PGDS antibody: synthetic peptide directed towards the N terminal of human PGDS. Synthetic peptide located within the following region: PNYKLTYFNMRGRAEIIRYIFAYLDIQYEDHRIEQADWPEIKSTLPFGKI