Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit anti-HPRT1 Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human HPRT1 |
Rabbit Polyclonal Anti-HPRT1 Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-HPRT1 antibody: synthetic peptide directed towards the middle region of human HPRT1. Synthetic peptide located within the following region: STGDIKVIGGDDLSTLTGKNVLIVEDIIDTGKTMQTLLSLVRQYNPKMVK |
HPRT (HPRT1) mouse monoclonal antibody, clone AT2G8, Purified
| Applications | ELISA, WB |
| Reactivities | Human |
HPRT (HPRT1) mouse monoclonal antibody, clone AT2G8, Purified
| Applications | ELISA, WB |
| Reactivities | Human |
HPRT (HPRT1) (C-term) rabbit polyclonal antibody
| Applications | WB |
| Reactivities | Human |
| Immunogen | KLH conjugated synthetic peptide selected from the C-terminal region of human HPRT1 |
Carrier-free (BSA/glycerol-free) HPRT1 mouse monoclonal antibody, clone OTI1H2 (formerly 1H2)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) HPRT1 mouse monoclonal antibody, clone OTI2H5 (formerly 2H5)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
HPRT Rabbit polyclonal Antibody
| Applications | IHC, IP, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthesized peptide derived from human HPRT |
HPRT1 mouse monoclonal antibody, clone OTI1H2 (formerly 1H2)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
HPRT1 mouse monoclonal antibody, clone OTI1H2 (formerly 1H2)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
HPRT1 mouse monoclonal antibody, clone OTI2H5 (formerly 2H5)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
HPRT1 mouse monoclonal antibody, clone OTI2H5 (formerly 2H5)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Active filters
Target Symbol
- HPRT1