Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Goat Polyclonal Antibody against HPS3 / Cocoa
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence PYLLYCSRKKPLT, from the C Terminus of the protein sequence according to NP_115759. |
Rabbit Polyclonal anti-Hps3 antibody
| Applications | WB |
| Reactivities | Rat |
| Immunogen | The immunogen for anti-Hps3 antibody: synthetic peptide corresponding to a region of Rat. Synthetic peptide located within the following region: LSRQRCTFSTLGRVLRMAYSEAGDYLVAIEEKNKTVFLRAYVNWRSKRND |
HPS3 rabbit polyclonal antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human HPS3 |
Active filters
Target Symbol
- HPS3