Antibodies

Jump to Filters
View as table Download
HPS3 Rabbit Polyclonal Antibody
TA308334

USD 415.00

5 Days

Rabbit Polyclonal antibody to HPS3 (Hermansky-Pudlak syndrome 3)

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region within amino acids 942 and 1004 of HPS3 (Uniprot ID#Q969F9)
HPS3 Goat Polyclonal Antibody
TA302495

USD 375.00

5 Days

Goat Polyclonal Antibody against HPS3 / Cocoa

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence PYLLYCSRKKPLT, from the C Terminus of the protein sequence according to NP_115759.
Hps3 Rabbit Polyclonal Antibody
TA329662

USD 375.00

5 Days

Rabbit Polyclonal anti-Hps3 antibody

Applications WB
Reactivities Rat
Immunogen The immunogen for anti-Hps3 antibody: synthetic peptide corresponding to a region of Rat. Synthetic peptide located within the following region: LSRQRCTFSTLGRVLRMAYSEAGDYLVAIEEKNKTVFLRAYVNWRSKRND
HPS3 Rabbit Polyclonal Antibody
TA366086

USD 380.00

4 Weeks

HPS3 rabbit polyclonal antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Fusion protein of human HPS3