Rabbit Polyclonal Antibody against HS2ST1
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This HS2ST1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 16-45 amino acids from the N-terminal region of human HS2ST1. |
Rabbit Polyclonal Anti-HS2ST1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-HS2ST1 antibody: synthetic peptide directed towards the N terminal of human HS2ST1. Synthetic peptide located within the following region: GLLRIMMPPKLQLLAVVAFAVAMLFLENQIQKLEESRSKLERAIARHEVR |
Rabbit Polyclonal Anti-HS2ST1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-HS2ST1 antibody: synthetic peptide directed towards the middle region of human HS2ST1. Synthetic peptide located within the following region: GVTEELEDFIMLLEAALPRFFRGATELYRTGKKSHLRKTTEKKLPTKQTI |
HS2ST1 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-229 of human HS2ST1 (NP_001127964.1). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China
