Rabbit Polyclonal Anti-HSD17B11 Antibody
| Applications | IHC |
| Reactivities | Monkey |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-HSD17B11 antibody: synthetic peptide directed towards the N terminal of human HSD17B11. Synthetic peptide located within the following region: TGEIVLITGAGHGIGRLTAYEFAKLKSKLVLWDINKHGLEETAAKCKGLG |
Hsd17b11 Antibody - middle region
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
HSD17B11 Antibody - C-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the C-terminal region of Human DHB11 |
Germany
Japan
United Kingdom
China
