Rabbit Polyclonal Anti-HSD17B14 Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-HSD17B14 antibody: synthetic peptide directed towards the middle region of human HSD17B14. Synthetic peptide located within the following region: QPAEVGAAAVFLASEANFCTGIELLVTGGAELGYGCKASRSTPVDAPDIP |
Rabbit Polyclonal Anti-HSD17B14 Antibody - N-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-HSD17B14 antibody: synthetic peptide directed towards the N terminal of human HSD17B14. Synthetic peptide located within the following region: RVVICDKDESGGRALEQELPGAVFILCDVTQEDDVKTLVSETIRRFGRLD |
Rabbit Polyclonal Anti-HSD17B14 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human HSD17B14 |
HSD17B14 rabbit polyclonal antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human HSD17B14 |
Germany
Japan
United Kingdom
China