Antibodies

View as table Download

HSF4 rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human HSF4

HSF4 (N-term) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 99-128 amino acids from the N-terminal region of humanHeat shock factor 4 / HSF4

Rabbit Polyclonal Anti-HSF4 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-HSF4 antibody: synthetic peptide directed towards the middle region of human HSF4. Synthetic peptide located within the following region: VTLRQSHGQQHRVIGKLIQCLFGPLQAGPSNAGGKRKLSLMLDEGSSCPT

HSF4 rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human HSF4